Recombinant Human YEATS4 Protein

Recombinant Human YEATS4 Protein
SKU
ASBPP-3430-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O95619

Gene Name: YEATS4

Expression System: Escherichia coli

Molecular Weight: 27.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Ile227

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: GAS41

Alternative protein names: YEATS domain-containing protein 4; Glioma-amplified sequence 41; Gas41; NuMA-binding protein 1; NuBI-1; NuBI1

Protein name: YEATS domain containing 4

Full length: 227 amino acids

Entry name: YETS4_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3430-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3430-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 8089
Product information (PDF)
×
MSDS (PDF)
×