Recombinant Human YIPF2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BWQ6

Gene Name: YIPF2

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Glu11

End Site: Gly100

Coverage: 0.34

Isoelectric Point: 3.5

Core Sequence: EFEEATNLLADTPDAATTSRSDQLTPQGHVAVAVGSGGSYGAEDEVEEESDKAALLQEQQQQQQPGFWTFSYYQSFFDVDTSQVLDRIKG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 75%, Pig - 85%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Protein YIPF2; YIP1 family member 2

Protein name: Yip1 domain family member 2

Full length: 316 amino acids

Entry name: YIPF2_HUMAN

• SKU: ASBPP-3391-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3391-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 78992