Recombinant Human YOD1 Protein

Recombinant Human YOD1 Protein
SKU
ASBPP-3853-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q5VVQ6

Gene Name: YOD1

Expression System: Escherichia coli

Molecular Weight: 39.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Met1

End Site: Val348

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MFGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQGLSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 89%, Pig - 92%, Cynomolgus monkey - 98%

Alternative gene names: DUBA8; HIN7; OTUD2

Alternative protein names: Ubiquitin thioesterase OTU1; DUBA-8; HIV-1-induced protease 7; HIN-7; HsHIN7; OTU domain-containing protein 2

Protein name: YOD1 deubiquitinase

Full length: 348 amino acids

Entry name: OTU1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3853-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3853-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 55432
Product information (PDF)
×
MSDS (PDF)
×