Recombinant Human ZBED2 Protein

Recombinant Human ZBED2 Protein
SKU
ASBPP-3841-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BTP6

Gene Name: ZBED2

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 43%

Start Site: Glu21

End Site: Ala180

Coverage: 0.78

Isoelectric Point: 9

Core Sequence: EMKEEEEISETGELVGPFVSAMPTPMPHNKGTRFSEAWEYFHLAPARAGHHPNQYATCRLCGRQVSRGPGVNVGTTALWKHLKSMHREELEKSGHGQAGQRQDPRPHGPQLPTGIEGNWGRLLEQVGTMALWASQREKEVLRRERAVEWRERAVEKRERA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 43%, Pig - 87%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger BED domain-containing protein 2

Protein name: zinc finger BED-type containing 2

Full length: 218 amino acids

Entry name: ZBED2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3841-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3841-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 79413
Product information (PDF)
×
MSDS (PDF)
×