Recombinant Human ZBTB1 Protein

Recombinant Human ZBTB1 Protein
SKU
ASBPP-2953-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y2K1

Gene Name: ZBTB1

Expression System: Escherichia coli

Molecular Weight: 42 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Cys221

End Site: Asn570

Coverage: 0.50

Isoelectric Point: 4.5

Core Sequence: CGFGFSCEKLLDEHVLTCTNRHLYQNTRSYHRIVDIRDGKDSNIKAEFGEKDSSKTFSAQTDKYRGDTSQAADDSASTTGSRKSSTVESEIASEEKSRAAERKRIIIKMEPEDIPTDELKDFNIIKVTDKDCNESTDNDELEDEPEEPFYRYYVEEDVSIKKSGRKTLKPRMSVSADERGGLENMRPPNNSSPVQEDAENASCELCGLTITEEDLSSHYLAKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNGLGNTEEKMDLEENPDEQSEIRDMFVEMLDDFRDNHYQINSIQKKQLFKHSACPFRCPNCGQRFETENLVVEHMSSCLDQDMFKSAIMEEN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Pig - 96%, Cynomolgus monkey - 98%

Alternative gene names: KIAA0997

Alternative protein names: Zinc finger and BTB domain-containing protein 1

Protein name: zinc finger and BTB domain containing 1

Full length: 713 amino acids

Entry name: ZBTB1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2953-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2953-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 22890
Product information (PDF)
×
MSDS (PDF)
×