Recombinant Human ZBTB2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N680

Gene Name: ZBTB2

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ala151

End Site: Arg360

Coverage: 0.43

Isoelectric Point: 6

Core Sequence: APEKLGRDPRPQTSRISQEQVPEASQLSQLTSNLAQVNRTNMTPSDPLQTSLSPELVSTPVPPPPPGEETNLEASSSDEQPASLTIAHVKPSIMKRNGSFPKYYACHLCGRRFTLRSSLREHLQIHTGVPFTSSQQGESRVPLTLCSNAADLGKDAMEVPEAGMISDSELQHISDSPIIDGQQQSETPPPSDIADIDNLEQADQEREVKR

Homologies: Highest protein sequence identity to the following orthologs: Pig - 91%, Cynomolgus monkey - 98%

Alternative gene names: KIAA1483; ZNF437

Alternative protein names: Zinc finger and BTB domain-containing protein 2

Protein name: zinc finger and BTB domain containing 2

Full length: 514 amino acids

Entry name: ZBTB2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10478-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10478-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 57621