Recombinant Human ZBTB43 Protein

Recombinant Human ZBTB43 Protein
SKU
ASBPP-3552-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O43298

Gene Name: ZBTB43

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Glu191

End Site: Asp290

Coverage: 0.23

Isoelectric Point: 5.5

Core Sequence: EHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHYTRPMYSKPSIMAHKRWIHVKPERLEQACEGMDVHATYDEHQVTESINTVQTEHTVQPSGVEED

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: KIAA0414; ZBTB22B; ZNF297B

Alternative protein names: Zinc finger and BTB domain-containing protein 43; Zinc finger and BTB domain-containing protein 22B; Zinc finger protein 297B; ZnF-x

Protein name: zinc finger and BTB domain containing 43

Full length: 467 amino acids

Entry name: ZBT43_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3552-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3552-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 23099
Product information (PDF)
×
MSDS (PDF)
×