Recombinant Human ZBTB8B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NAP8

Gene Name: ZBTB8B

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 67%

Start Site: Leu211

End Site: Ala290

Coverage: 0.19

Isoelectric Point: 5

Core Sequence: LGGGSADSNLSTPPKRIEPKVEFDADEVEVDVGEQLQQYAAPLNLAHVEEALPSGQAVDLAYSNYHVKQFLEALLRNSAA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%, Pig - 77%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Zinc finger and BTB domain-containing protein 8B

Protein name: zinc finger and BTB domain containing 8B

Full length: 495 amino acids

Entry name: ZBT8B_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3613-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3613-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 728116