Recombinant Human ZC3H7A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IWR0

Gene Name: ZC3H7A

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Asp831

End Site: Pro900

Coverage: 0.08

Isoelectric Point: 7

Core Sequence: DIASQSNKENGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFP

Homologies: Highest protein sequence identity to the following orthologs: Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: ZC3H7; ZC3HDC7

Alternative protein names: Zinc finger CCCH domain-containing protein 7A

Protein name: zinc finger CCCH-type containing 7A

Full length: 971 amino acids

Entry name: Z3H7A_HUMAN

• SKU: ASBPP-3616-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3616-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 29066