Recombinant Human ZCCHC9 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N567

Gene Name: ZCCHC9

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Tyr11

End Site: Gln150

Coverage: 0.53

Isoelectric Point: 10.5

Core Sequence: YNKRPLPATSWEDMKKGSFEGTSQNLPKRKQLEANRLSLKNDAPQAKHKKNKKKKEYLNEDVNGFMEYLRQNSQMVHNGQIIATDSEEVREEIAVALKKDSRREGRRLKRQAAKKNAMVCFHCRKPGHGIADCPAALENQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Pig - 86%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Zinc finger CCHC domain-containing protein 9

Protein name: zinc finger CCHC-type containing 9

Full length: 271 amino acids

Entry name: ZCHC9_HUMAN

• SKU: ASBPP-3559-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3559-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 84240