Recombinant Human ZFP2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZN57

Gene Name: ZFP2

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 52%

Start Site: Leu21

End Site: Ile90

Coverage: 0.17

Isoelectric Point: 6.5

Core Sequence: LEGQQDSHLSQVGVTHKETFTEMRVCGGNEFERCSSQDSILDTQQSIPMVKRPHNCNSHGEDATQNSELI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 52%, Pig - 48%, Cynomolgus monkey - 91%

Alternative gene names: ZNF751

Alternative protein names: Zinc finger protein ZFP2; Zfp-2; Zinc finger protein 751

Protein name: ZFP2 zinc finger protein

Full length: 461 amino acids

Entry name: ZFP2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3554-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3554-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 80108