Recombinant Human ZFP28 Protein

Recombinant Human ZFP28 Protein
SKU
ASBPP-3384-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8NHY6

Gene Name: ZFP28

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Lys741

End Site: His830

Coverage: 0.11

Isoelectric Point: 10.5

Core Sequence: KSSLICHRRSHTGEKPYECSVCGKAFSHRQSLSVHQRIHSGKKPYECKECRKTFIQIGHLNQHKRVHTGERSYNYKKSRKVFRQTAHLAH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 56%, Pig - 87%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1431

Alternative protein names: Zinc finger protein 28 homolog; Zfp-28; Krueppel-like zinc finger factor X6

Protein name: ZFP28 zinc finger protein

Full length: 868 amino acids

Entry name: ZFP28_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3384-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3384-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 140612
Product information (PDF)
×
MSDS (PDF)
×