Recombinant Human ZFP41 Protein

Recombinant Human ZFP41 Protein
SKU
ASBPP-3407-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8N8Y5

Gene Name: ZFP41

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Thr11

End Site: Val130

Coverage: 0.66

Isoelectric Point: 9

Core Sequence: TPTPREEADVQKSALREEKVSGDRKPPERPTVPRKPRTEPCLSPEDEEHVFDAFDASFKDDFEGVPVFIPFQRKKPYECSECGRIFKHKTDHIRHQRVHTGEKPFKCAQCGKAFRHSSDV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 58%, Pig - 59%, Cynomolgus monkey - 80%

Alternative gene names: /

Alternative protein names: Zinc finger protein 41 homolog; Zfp-41

Protein name: ZFP41 zinc finger protein

Full length: 198 amino acids

Entry name: ZFP41_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3407-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3407-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 286128
Product information (PDF)
×
MSDS (PDF)
×