Recombinant Human ZFP57 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NU63

Gene Name: ZFP57

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 34%

Start Site: Gly181

End Site: His290

Coverage: 0.25

Isoelectric Point: 9.5

Core Sequence: GKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGTQAEFQTPIARSQRSIQGLLDVNHAPVARSQEPIFRTEGPMAQNQASVLKNQAPVTRTQAPITGTLCQDARSNSH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 34%, Rat - 41%, Pig - 52%, Cynomolgus monkey - 92%

Alternative gene names: C6orf40; ZNF698

Alternative protein names: Zinc finger protein 57 homolog; Zfp-57; Zinc finger protein 698

Protein name: ZFP57 zinc finger protein

Full length: 452 amino acids

Entry name: ZFP57_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3609-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3609-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 346171