Recombinant Human ZFP82 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N141

Gene Name: ZFP82

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Glu131

End Site: Thr210

Coverage: 0.16

Isoelectric Point: 10

Core Sequence: ERPQEGYFSSVKMPSEKVSSYQKRTSVTPHQRLHFVDKPYECKECGKAFRVRQQLTFHHRIHTGEKPYECKECGMAFRQT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 54%, Pig - 88%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1948; ZNF545

Alternative protein names: Zinc finger protein 82 homolog; Zfp-82; Zinc finger protein 545

Protein name: ZFP82 zinc finger protein

Full length: 532 amino acids

Entry name: ZFP82_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3387-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3387-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 284406