Recombinant Human ZKSCAN4 Protein

Recombinant Human ZKSCAN4 Protein
SKU
ASBPP-3496-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q969J2

Gene Name: ZKSCAN4

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Ser211

End Site: Cys350

Coverage: 0.27

Isoelectric Point: 7.5

Core Sequence: SRLTPGSQGLLKMEDVALTLTPGWTQLDSSQVNLYRDEKQENHSSLVSLGGEIQTKSRDLPPVKKLPEKEHGKICHLREDIAQIPTHAEAGEQEGRLQRKQKNAIGSRRHYCHECGKSFAQSSGLTKHRRIHTGEKPYEC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Rat - 30%, Pig - 78%, Cynomolgus monkey - 93%

Alternative gene names: ZNF307; ZNF427

Alternative protein names: Zinc finger protein with KRAB and SCAN domains 4; P373c6.1; Zinc finger protein 307; Zinc finger protein 427

Protein name: zinc finger with KRAB and SCAN domains 4

Full length: 545 amino acids

Entry name: ZKSC4_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3496-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3496-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 387032
Product information (PDF)
×
MSDS (PDF)
×