Recombinant Human ZNF135 Protein

Recombinant Human ZNF135 Protein
SKU
ASBPP-3402-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P52742

Gene Name: ZNF135

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: Pro151

End Site: Arg240

Coverage: 0.14

Isoelectric Point: 9

Core Sequence: PVKTPVLEQWQRNGFGENISLNPDLPHQPMTPERQSPHTWGTRGKREKPDLNVLQKTCVKEKPYKCQECGKAFSHSSALIEHHRTHTGER

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Rat - 62%, Pig - 74%, Cynomolgus monkey - 91%

Alternative gene names: ZNF61; ZNF78L1

Alternative protein names: Zinc finger protein 135; Zinc finger protein 61; Zinc finger protein 78-like 1

Protein name: zinc finger protein 135

Full length: 658 amino acids

Entry name: ZN135_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3402-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3402-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7694
Product information (PDF)
×
MSDS (PDF)
×