Recombinant Human ZNF136 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P52737

Gene Name: ZNF136

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 67%

Start Site: Thr441

End Site: Gln520

Coverage: 0.17

Isoelectric Point: 9.5

Core Sequence: THTGEKPYECKQCGKAFSYLNSFRTHEMIHTGEKPFECKRCGKAFRSSSSFRLHERTHTGQKPYHCKECGKAYSCRASFQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%, Rat - 67%, Pig - 70%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Zinc finger protein 136

Protein name: zinc finger protein 136

Full length: 540 amino acids

Entry name: ZN136_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3405-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3405-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 7695