Recombinant Human ZNF138 Protein

Recombinant Human ZNF138 Protein
SKU
ASBPP-3565-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P52744

Gene Name: ZNF138

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 55%

Start Site: Met91

End Site: Ile180

Coverage: 0.39

Isoelectric Point: 10.5

Core Sequence: MHKFSNSNRHKIRHTENKHFRCKECDKSLCMLSRLTQHKKIHTRENFYKCEECGKTFNWSTNLSKPKKIHTGEKPYKCEVCGKAFHQSSI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 55%, Rat - 49%, Pig - 49%, Cynomolgus monkey - 73%

Alternative gene names: /

Alternative protein names: Zinc finger protein 138

Protein name: zinc finger protein 138

Full length: 262 amino acids

Entry name: ZN138_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3565-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3565-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7697
Product information (PDF)
×
MSDS (PDF)
×