Recombinant Human ZNF14 Protein

Recombinant Human ZNF14 Protein
SKU
ASBPP-3508-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P17017

Gene Name: ZNF14

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 49%

Start Site: Val11

End Site: Cys80

Coverage: 0.13

Isoelectric Point: 6

Core Sequence: VNFTLEEWALLDSSQKKLYEDVMQETFKNLVCLGKKWEDQDIEDDHRNQGKNRRCHMVERLCESRRGSKC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 49%, Rat - 51%, Pig - 65%, Cynomolgus monkey - 97%

Alternative gene names: GIOT4; KOX6

Alternative protein names: Zinc finger protein 14; Gonadotropin-inducible ovary transcription repressor 4; GIOT-4; Zinc finger protein KOX6

Protein name: zinc finger protein 14

Full length: 642 amino acids

Entry name: ZNF14_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3508-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3508-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7561
Product information (PDF)
×
MSDS (PDF)
×