Recombinant Human ZNF14 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P17017

Gene Name: ZNF14

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 49%

Start Site: Val11

End Site: Cys80

Coverage: 0.13

Isoelectric Point: 6

Core Sequence: VNFTLEEWALLDSSQKKLYEDVMQETFKNLVCLGKKWEDQDIEDDHRNQGKNRRCHMVERLCESRRGSKC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 49%, Rat - 51%, Pig - 65%, Cynomolgus monkey - 97%

Alternative gene names: GIOT4; KOX6

Alternative protein names: Zinc finger protein 14; Gonadotropin-inducible ovary transcription repressor 4; GIOT-4; Zinc finger protein KOX6

Protein name: zinc finger protein 14

Full length: 642 amino acids

Entry name: ZNF14_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3508-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3508-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 7561