Recombinant Human ZNF155 Protein

Recombinant Human ZNF155 Protein
SKU
ASBPP-3395-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q12901

Gene Name: ZNF155

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 43%

Start Site: Lys11

End Site: Gly200

Coverage: 0.37

Isoelectric Point: 6

Core Sequence: KDVAVVFTEEELGLLDPAQRKLYRDVMLENFRNLLSVGHQPFHQDTCHFLREEKFWMMGTATQREGNSGGKIQTELESVPEAGAHEEWSCQQIWEQIAKDLTRSQDSIINNSQFFENGDVPSQVEAGLPTIHTGQKPSQGGKCKQSISDVPIFDLPQQLYSEEKSYTCDECGKSICYISALHVHQRVHVG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 43%, Rat - 31%, Pig - 59%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Zinc finger protein 155

Protein name: zinc finger protein 155

Full length: 538 amino acids

Entry name: ZN155_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3395-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3395-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7711
Product information (PDF)
×
MSDS (PDF)
×