Recombinant Human ZNF17 Protein

Recombinant Human ZNF17 Protein
SKU
ASBPP-3415-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P17021

Gene Name: ZNF17

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 39%

Start Site: Glu11

End Site: Ser160

Coverage: 0.24

Isoelectric Point: 6.5

Core Sequence: EDVAIHFSQEEWGILNDVQRHLHSDVMLENFALLSSVGCWHGAKDEEAPSKQCVSVGVSQVTTLKPALSTQKAQPCETCSSLLKDILHLAEHDGTHPKRTAKLYLHQKEHLREKLTRSDEGRPSFVNDSVHLAKRNLTCMQGGKDFTGDS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 39%, Rat - 36%, Pig - 49%, Cynomolgus monkey - 94%

Alternative gene names: KIAA1947; KOX10

Alternative protein names: Zinc finger protein 17; Zinc finger protein HPF3; Zinc finger protein KOX10

Protein name: zinc finger protein 17

Full length: 662 amino acids

Entry name: ZNF17_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3415-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3415-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7565
Product information (PDF)
×
MSDS (PDF)
×