Recombinant Human ZNF19 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P17023

Gene Name: ZNF19

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Lys91

End Site: Pro160

Coverage: 0.17

Isoelectric Point: 7

Core Sequence: KDVETNIDSESTLIQGISEERDGMMSHGQLKSVPQRTDFPETRNVEKHQDIPTVKNIQGKVPRIPCARKP

Homologies: Highest protein sequence identity to the following orthologs: Cynomolgus monkey - 91%

Alternative gene names: KOX12

Alternative protein names: Zinc finger protein 19; Zinc finger protein KOX12

Protein name: zinc finger protein 19

Full length: 458 amino acids

Entry name: ZNF19_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3453-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3453-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 7567