Recombinant Human ZNF195 Protein

Recombinant Human ZNF195 Protein
SKU
ASBPP-3466-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O14628

Gene Name: ZNF195

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 66%

Start Site: Cys471

End Site: His540

Coverage: 0.13

Isoelectric Point: 8.5

Core Sequence: CGKVFRTCSSLSNHKRTHSEEKPYTCEECGNIFKQLSDLTKHKKTHTGEKPYKCDECGKNFTQSSNLIVH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 66%, Rat - 64%, Pig - 66%, Cynomolgus monkey - 100%

Alternative gene names: ZNFP104

Alternative protein names: Zinc finger protein 195

Protein name: zinc finger protein 195

Full length: 629 amino acids

Entry name: ZN195_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3466-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3466-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7748
Product information (PDF)
×
MSDS (PDF)
×