Recombinant Human ZNF211 Protein

Recombinant Human ZNF211 Protein
SKU
ASBPP-3373-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q13398

Gene Name: ZNF211

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Ser441

End Site: Gln520

Coverage: 0.15

Isoelectric Point: 8.5

Core Sequence: SSHRKVHTGERPYVCGECGKSFSHSSNLKNHQRVHTGERPVECSECSKSFSCKSNLIKHLRVHTGERPYECSECGKSFSQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Rat - 65%, Pig - 90%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Zinc finger protein 211; Zinc finger protein C2H2-25

Protein name: zinc finger protein 211

Full length: 564 amino acids

Entry name: ZN211_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3373-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3373-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10520
Product information (PDF)
×
MSDS (PDF)
×