Recombinant Human ZNF213 Protein

Recombinant Human ZNF213 Protein
SKU
ASBPP-3635-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O14771

Gene Name: ZNF213

Expression System: Escherichia coli

Molecular Weight: 33.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 59%

Start Site: Ala11

End Site: Leu290

Coverage: 0.62

Isoelectric Point: 4.5

Core Sequence: APGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACRQRFRQFCYGDVHGPHEAFSQLWELCCRWLRPELRTKEQILELLVLEQFLTVLPGEIQGWVREQHPGSGEEAVALVEDLQKQPVKAWRQDVPSEEAEPEAAGRGSQATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPVALGDIPFYFSREEWGTLDPAQRDLFWDIKRENSRNTTLGFGLKGQSEKSLLQEMVPVVPGQTGSDVTVSWSPEEAEAWESENRPRAAL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 59%, Rat - 38%, Pig - 76%, Cynomolgus monkey - 92%

Alternative gene names: ZKSCAN21

Alternative protein names: Zinc finger protein 213; Putative transcription factor CR53; Zinc finger protein with KRAB and SCAN domains 21

Protein name: zinc finger protein 213

Full length: 459 amino acids

Entry name: ZN213_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3635-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3635-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7760
Product information (PDF)
×
MSDS (PDF)
×