Recombinant Human ZNF222 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UK12

Gene Name: ZNF222

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 49%

Start Site: Lys11

End Site: Val110

Coverage: 0.24

Isoelectric Point: 5

Core Sequence: KDVAVIFTEEELGLLDPAQRKLYRDVMLENFRNLLSVGGKIQTEMETVPEAGTHEEFSCKQIWEQIASDLTRSQDTTISNSQLFEQDDNPSQIKARLSTV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 49%, Rat - 63%, Pig - 70%, Cynomolgus monkey - 71%

Alternative gene names: /

Alternative protein names: Zinc finger protein 222

Protein name: zinc finger protein 222

Full length: 451 amino acids

Entry name: ZN222_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3568-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3568-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 7673