Recombinant Human ZNF223 Protein

Recombinant Human ZNF223 Protein
SKU
ASBPP-3570-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UK11

Gene Name: ZNF223

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Lys11

End Site: Arg170

Coverage: 0.36

Isoelectric Point: 6

Core Sequence: KDVAVVFTEEELGLLDLAQRKLYRDVMLENFRNLLSVGHQPFHRDTFHFLREEKFWMMDIATQREGNSGGKIQPEMKTFPEAGPHEGWSCQQIWEEIASDLTRPQDSTIKSSQFFEQGDAHSQVEEGLSIMHTGQKPSNCGKCKQSFSDMSIFDLPQQIR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Rat - 40%, Pig - 59%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Zinc finger protein 223

Protein name: zinc finger protein 223

Full length: 482 amino acids

Entry name: ZN223_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3570-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3570-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7766
Product information (PDF)
×
MSDS (PDF)
×