Recombinant Human ZNF227 Protein

Recombinant Human ZNF227 Protein
SKU
ASBPP-3574-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q86WZ6

Gene Name: ZNF227

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Pro491

End Site: Glu580

Coverage: 0.12

Isoelectric Point: 9

Core Sequence: PYKCKECGKGFSQASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHQRVHTGEKPYRCDVCGKDFSYSSNLKLHQVIHTGEKPYKCEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 66%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Zinc finger protein 227

Protein name: zinc finger protein 227

Full length: 799 amino acids

Entry name: ZN227_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3574-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3574-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7770
Product information (PDF)
×
MSDS (PDF)
×