Recombinant Human ZNF230 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UIE0

Gene Name: ZNF230

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 50%

Start Site: Lys371

End Site: Cys450

Coverage: 0.18

Isoelectric Point: 8.5

Core Sequence: KGYISKSGLNLHQRVHTGERPYNCKECGKSFSRASSILNHKKLHCRKKPFKCEDCGKRLVHRSFCKDQQGDHNGENSSKC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 50%, Rat - 47%, Pig - 52%, Cynomolgus monkey - 99%

Alternative gene names: FDZF2

Alternative protein names: Zinc finger protein 230; Zinc finger protein FDZF2

Protein name: zinc finger protein 230

Full length: 474 amino acids

Entry name: ZN230_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3578-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3578-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 7773