Recombinant Human ZNF232 Protein

Recombinant Human ZNF232 Protein
SKU
ASBPP-2942-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UNY5

Gene Name: ZNF232

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Ser181

End Site: Ala340

Coverage: 0.40

Isoelectric Point: 7

Core Sequence: SEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEVESQVFSEKLATDTSTFEATSEGTLELQQRNPKAERLRWSPAQEESFRQMVVIHKEIPTGKKDHECSECGKTFIYNSHLVVHQRVHSGEKPYKCSDCGKTFKQSSNLGQHQRIHTGEKPFECNECGKA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Rat - 64%, Pig - 72%, Cynomolgus monkey - 95%

Alternative gene names: ZSCAN11

Alternative protein names: Zinc finger protein 232; Zinc finger and SCAN domain-containing protein 11

Protein name: zinc finger protein 232

Full length: 417 amino acids

Entry name: ZN232_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2942-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2942-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7775
Product information (PDF)
×
MSDS (PDF)
×