Recombinant Human ZNF234 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q14588

Gene Name: ZNF234

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 31%

Start Site: Lys11

End Site: Glu180

Coverage: 0.25

Isoelectric Point: 6.5

Core Sequence: KDVAVVFTEEELGLLDPVQRNLYQDVMLENFRNLLSVGHHPFKHDVFLLEKEKKLDIMKTATQRKGKSADKIQSEVETVPEAGRHEELYWGQIWKQIASDLIKYEDSMISISRFPRQGDLSCQVRAGLYTTHTGQKFYQCDEYKKSFTDVFNFDLHQQLHSGEKSHTCDE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 31%, Rat - 32%, Pig - 57%, Cynomolgus monkey - 93%

Alternative gene names: ZNF269

Alternative protein names: Zinc finger protein 234; Zinc finger protein 269; Zinc finger protein HZF4

Protein name: zinc finger protein 234

Full length: 700 amino acids

Entry name: ZN234_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3581-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3581-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 10780