Recombinant Human ZNF250 Protein

Recombinant Human ZNF250 Protein
SKU
ASBPP-3586-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P15622

Gene Name: ZNF250

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 43%

Start Site: Asn101

End Site: Asn170

Coverage: 0.14

Isoelectric Point: 5.5

Core Sequence: NLKYDHTTACTQQDSLSCPWECETKGESQNTDLSPKPLISEQTVILGKTPLGRIDQENNETKQSFCLSPN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 43%, Pig - 49%, Cynomolgus monkey - 93%

Alternative gene names: ZNF647

Alternative protein names: Zinc finger protein 250; Zinc finger protein 647

Protein name: zinc finger protein 250

Full length: 560 amino acids

Entry name: ZN250_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3586-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3586-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 58500
Product information (PDF)
×
MSDS (PDF)
×