Recombinant Human ZNF251 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BRH9

Gene Name: ZNF251

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: His451

End Site: Gly540

Coverage: 0.14

Isoelectric Point: 9.5

Core Sequence: HRRVHTGEKPYQCVECGKAFSQSSQLTLHQRVHTGEKPYDCGDCGKAFSRRSTLIQHQKVHSGETRKCRKHGPAFVHGSSLTADGQIPTG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Rat - 59%, Pig - 75%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Zinc finger protein 251

Protein name: zinc finger protein 251

Full length: 671 amino acids

Entry name: ZN251_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3588-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3588-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 90987