Recombinant Human ZNF253 Protein

Recombinant Human ZNF253 Protein
SKU
ASBPP-3490-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O75346

Gene Name: ZNF253

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Gln211

End Site: Gly290

Coverage: 0.17

Isoelectric Point: 9

Core Sequence: QSANLTTHKRIHTGEKPYRCEECGKAFKQSSNLTTHKKIHTGEKPYKCEECGKAFNRSTDLTTHKIVHTGEKPYKCEECG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 68%, Pig - 72%, Cynomolgus monkey - 98%

Alternative gene names: BMZF1; ZNF411

Alternative protein names: Zinc finger protein 253; Bone marrow zinc finger 1; BMZF-1; Zinc finger protein 411

Protein name: zinc finger protein 253

Full length: 499 amino acids

Entry name: ZN253_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3490-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3490-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 56242
Product information (PDF)
×
MSDS (PDF)
×