Recombinant Human ZNF254 Protein

Recombinant Human ZNF254 Protein
SKU
ASBPP-3589-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O75437

Gene Name: ZNF254

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: Gly11

End Site: Asn140

Coverage: 0.21

Isoelectric Point: 6.5

Core Sequence: GLLTFRDVAIEFSLEEWQHLDIAQQNLYRNVMLENYRNLAFLGIAVSKPDLITCLEQGKEPWNMKRHEMVDEPPGMCPHFAQDLWPEQGMEDSFQKAILRRYGKYGHENLQLRKGCKSVDEYKVNKEGYN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Rat - 53%, Pig - 56%, Cynomolgus monkey - 90%

Alternative gene names: BMZF5; ZNF539; ZNF91L

Alternative protein names: Zinc finger protein 254; Bone marrow zinc finger 5; BMZF-5; Hematopoietic cell-derived zinc finger protein 1; HD-ZNF1; Zinc finger protein 539; Zinc finger protein 91-like

Protein name: zinc finger protein 254

Full length: 659 amino acids

Entry name: ZN254_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3589-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3589-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9534
Product information (PDF)
×
MSDS (PDF)
×