Recombinant Human ZNF26 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P17031

Gene Name: ZNF26

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 63%

Start Site: Leu441

End Site: Trp510

Coverage: 0.15

Isoelectric Point: 8.5

Core Sequence: LIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQKSSLSEHQRVHTGEKPW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 63%, Rat - 63%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: KOX20

Alternative protein names: Zinc finger protein 26; Zinc finger protein KOX20

Protein name: zinc finger protein 26

Full length: 533 amino acids

Entry name: ZNF26_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3382-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3382-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 7574