Recombinant Human ZNF283 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N7M2

Gene Name: ZNF283

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 55%

Start Site: Gly71

End Site: Glu150

Coverage: 0.12

Isoelectric Point: 4.5

Core Sequence: GLVTFRDVAIDFSQEEWECLDPAQRDLYVDVMLENYSNLVSLDLESKTYETKKIFSENDIFEINFSQWEMKDKSKTLGLE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 55%, Rat - 70%, Pig - 75%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Zinc finger protein 283; Zinc finger protein HZF19

Protein name: zinc finger protein 283

Full length: 679 amino acids

Entry name: ZN283_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3409-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3409-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 284349