Recombinant Human ZNF285 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96NJ3

Gene Name: ZNF285

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 45%

Start Site: His181

End Site: Lys280

Coverage: 0.18

Isoelectric Point: 7

Core Sequence: HDDSLSWTSCDHHESQECKGEDPGRHPSCGKNLGMKSTVEKRNAAHVLPQPFPCNNCGVAFADDTDPHVHHSTHLGEKSYKCDQYGKNFSQSQDLIVHCK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 45%, Rat - 39%, Pig - 43%, Cynomolgus monkey - 84%

Alternative gene names: ZNF285A

Alternative protein names: Zinc finger protein 285; Zinc finger protein 285A

Protein name: zinc finger protein 285

Full length: 590 amino acids

Entry name: ZN285_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3533-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3533-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 26974