Recombinant Human ZNF296 Protein

Recombinant Human ZNF296 Protein
SKU
ASBPP-3514-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8WUU4

Gene Name: ZNF296

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Ser271

End Site: Asn400

Coverage: 0.27

Isoelectric Point: 9

Core Sequence: SSKLNRHKKTHRQVPPQSPLMADTSQEQASAAPPEPAVHAAAPTSTLPCSGGEGAGAAATAGVQEPGAPGSGAQAGPGGDTWGAITTEQRTDPANSQKASPKKMPKSGGKSRGPGGSCEFCGKHFTNSSN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Pig - 82%, Cynomolgus monkey - 96%

Alternative gene names: ZNF342

Alternative protein names: Zinc finger protein 296; ZFP296; Zinc finger protein 342

Protein name: zinc finger protein 296

Full length: 475 amino acids

Entry name: ZN296_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3514-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3514-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 162979
Product information (PDF)
×
MSDS (PDF)
×