Recombinant Human ZNF304 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HCX3

Gene Name: ZNF304

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Leu291

End Site: Gln380

Coverage: 0.15

Isoelectric Point: 10

Core Sequence: LHHLKMHQKFHTGKRHYTCSECGKAFSRKDTLVQHQRVHTGERSYDCSECGKAYSRSSHLVQHQRIHTGERPYKCNKCGKAFSRKDTLVQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Rat - 59%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 304; KRAB-containing zinc finger protein

Protein name: zinc finger protein 304

Full length: 659 amino acids

Entry name: ZN304_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3428-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3428-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 57343