Recombinant Human ZNF311 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5JNZ3

Gene Name: ZNF311

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ala141

End Site: Ala250

Coverage: 0.16

Isoelectric Point: 7.5

Core Sequence: ADKMWPENEKASSQQEIFENGEAYWMKFNSLLKVDSRDPKVREVCVQDVKLENQWETSIREKLREEKEGSEEVTCKKGKNQKVLSKNLNPNSKHSQCNKVLIAQKLHECA

Homologies: Highest protein sequence identity to the following orthologs: Pig - 66%, Cynomolgus monkey - 83%

Alternative gene names: ZFP31

Alternative protein names: Zinc finger protein 311; Zinc finger protein zfp-31

Protein name: zinc finger protein 311

Full length: 666 amino acids

Entry name: ZN311_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3646-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3646-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 282890