Recombinant Human ZNF316 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A6NFI3

Gene Name: ZNF316

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Thr151

End Site: Glu250

Coverage: 0.11

Isoelectric Point: 3.5

Core Sequence: TAGCQELVTFEDVAVYFSLEEWERLEADQRGLYQEVMQENYGILVSLGYPIPKPDLIFRLEQGEEPWVPDSPRPEEGDIVTGVYTGAWFWTDDIEDHEEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 60%, Pig - 89%, Cynomolgus monkey - 54%

Alternative gene names: /

Alternative protein names: Zinc finger protein 316

Protein name: zinc finger protein 316

Full length: 1004 amino acids

Entry name: ZN316_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3386-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3386-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 100131017