Recombinant Human ZNF317 Protein

Recombinant Human ZNF317 Protein
SKU
ASBPP-3461-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96PQ6

Gene Name: ZNF317

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 53%

Start Site: Ser11

End Site: Trp130

Coverage: 0.20

Isoelectric Point: 4.5

Core Sequence: STQDSTCLQDSEFPVSSKDHSCPQNLDLFVCSGLEPHTPSVGSQESVTFQDVAVDFTEKEWPLLDSSQRKLYKDVMLENYSNLTSLGYQVGKPSLISHLEQEEEPRTEERGAHQGACADW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 53%, Rat - 56%, Pig - 77%, Cynomolgus monkey - 96%

Alternative gene names: KIAA1588

Alternative protein names: Zinc finger protein 317

Protein name: zinc finger protein 317

Full length: 595 amino acids

Entry name: ZN317_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3461-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3461-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 57693
Product information (PDF)
×
MSDS (PDF)
×