Recombinant Human ZNF32 Protein

Recombinant Human ZNF32 Protein
SKU
ASBPP-10479-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P17041

Gene Name: ZNF32

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Ala21

End Site: Cys110

Coverage: 0.35

Isoelectric Point: 7.5

Core Sequence: AFFNVMTEAHHKYDHSEATGSSSWDIQNSFRREKLEQKSPDSKTLQEDSPGVRQRVYECQECGKSFRQKGSLTLHERIHTGQKPFECTHC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 60%, Pig - 85%, Cynomolgus monkey - 100%

Alternative gene names: KOX30

Alternative protein names: Zinc finger protein 32; C2H2-546; Zinc finger protein KOX30

Protein name: zinc finger protein 32

Full length: 273 amino acids

Entry name: ZNF32_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10479-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10479-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7580
Product information (PDF)
×
MSDS (PDF)
×