Recombinant Human ZNF320 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A2RRD8

Gene Name: ZNF320

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 49%

Start Site: Glu91

End Site: Pro160

Coverage: 0.16

Isoelectric Point: 7

Core Sequence: EKDIHDFVFQWQEDETNDHEAPMTEIKKLTSSTDRYDQRHAGNKPIKGQLESRFHLHLRRHRRIHTGEKP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 49%, Rat - 47%, Pig - 38%, Cynomolgus monkey - 85%

Alternative gene names: /

Alternative protein names: Zinc finger protein 320

Protein name: zinc finger protein 320

Full length: 509 amino acids

Entry name: ZN320_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3434-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3434-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 162967