Recombinant Human ZNF324B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6AW86

Gene Name: ZNF324B

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 54%

Start Site: Gly431

End Site: Arg530

Coverage: 0.19

Isoelectric Point: 11

Core Sequence: GRSFSRSSNLTQHQLLHTGERPFRCVDCGKGFAKGAVLLSHRRIHTGEKPFVCTQCGRAFRERPALLHHQRIHTTEKTNAAAPDCTPGPGFLQGHHRKVR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 54%, Rat - 57%, Pig - 88%, Cynomolgus monkey - 59%

Alternative gene names: /

Alternative protein names: Zinc finger protein 324B

Protein name: zinc finger protein 324B

Full length: 544 amino acids

Entry name: Z324B_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3541-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3541-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 388569