Recombinant Human ZNF329 Protein

Recombinant Human ZNF329 Protein
SKU
ASBPP-3441-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q86UD4

Gene Name: ZNF329

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 53%

Start Site: Leu101

End Site: Arg170

Coverage: 0.15

Isoelectric Point: 9.5

Core Sequence: LDCDPALPSYPKSYADKRTGDSDACGKGFNHSMEVIHGRNPVREKPYKYPESVKSFNHFTSLGHQKIMKR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 53%, Rat - 34%, Pig - 70%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Zinc finger protein 329

Protein name: zinc finger protein 329

Full length: 541 amino acids

Entry name: ZN329_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3441-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3441-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 79673
Product information (PDF)
×
MSDS (PDF)
×