Recombinant Human ZNF331 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NQX6

Gene Name: ZNF331

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Pro111

End Site: Lys190

Coverage: 0.18

Isoelectric Point: 9.5

Core Sequence: PATREGTPPRTHQRHHKENSFECKDCGKAFSRGYQLSQHQKIHTGEKPYECKECKKAFRWGNQLTQHQKIHTGEKPYECK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Rat - 57%, Pig - 84%, Cynomolgus monkey - 98%

Alternative gene names: RITA; ZNF361; ZNF463

Alternative protein names: Zinc finger protein 331; C2H2-like zinc finger protein rearranged in thyroid adenomas; Zinc finger protein 361; Zinc finger protein 463

Protein name: zinc finger protein 331

Full length: 463 amino acids

Entry name: ZN331_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3435-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3435-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 55422